Property Summary

NCBI Gene PubMed Count 17
PubMed Score 64.76
PubTator Score 34.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
chronic rhinosinusitis 3.056 1.4e-02
intraductal papillary-mucinous neoplasm ... 2.200 6.9e-03
non-small cell lung cancer -1.116 6.6e-09
pancreatic cancer 1.400 1.2e-02
periodontitis 1.400 1.6e-15
psoriasis -1.100 2.4e-02

Gene RIF (10)

AA Sequence

MKIIILLGFLGATLSAPLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIP      1 - 70
GLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQG     71 - 140
QMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTA    141 - 210
PEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP     211 - 279
//

Text Mined References (19)

PMID Year Title