Property Summary

NCBI Gene PubMed Count 15
Grant Count 18
Funding $5,567,953.9
PubMed Score 63.22
PubTator Score 34.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
periodontitis 1.400 0.000
non-small cell lung cancer -1.116 0.000
intraductal papillary-mucinous neoplasm ... 2.200 0.007
pancreatic cancer 1.400 0.012
chronic rhinosinusitis 3.056 0.014
psoriasis -1.100 0.024

Gene RIF (8)

PMID Text
26358398 ODAM induced RhoA activity. ODAM-mediated RhoA signalling resulted in actin filament rearrangement, increased cell adhesion and inhibited the migration/invasion of MCF7 cells. These results suggest that ODAM expression maintains their adhesion, resulting in the prevention of their metastasis via the regulation of RhoA signalling in breast cancer cells.
23648148 Our studies demonstrate that ectopic ODAM expression in melanoma cell lines suppresses growth and migratory activity in these cells, while eliciting elevated PTEN expression and suppression of AKT activity.
22387195 We propose that ODAM has diverse functions that vary with protein location in various cell lines. Nuclear ODAM appears to be associated with MMP-20 regulation and tumorigenesis. Additional functions may take place in cytoplasm and extracellular matrix.
20572917 The expression of APIN at an early time-point following disruption of periodontal integrity suggests that this protein may be part of the cascade of events leading to the activation of ERM during periodontal healing and regeneration
18484335 Confirmation of the amyloidogenic potential of ODAM has resulted from analyses of four other cases where we found, in addition, a 74-residue segment specified by exon 4.
18472969 Data suggest that ODAM is a developmental antigen that has an essential role in tooth maturation and in the pathogenesis of certain odontogenic and other epithelial neoplasms
17647262 The protein sequences deduced from the cloned cDNA for rat, mouse, pig, and human were aligned together with those obtained from four other mammal genomes. Apin is highly conserved in mammals.
14647039 Calcifying epithelial odontogenic tumor-associated amyloid consists of a unique and previously undescribed protein that we provisionally designate APin.

AA Sequence

MKIIILLGFLGATLSAPLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIP      1 - 70
GLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQG     71 - 140
QMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTA    141 - 210
PEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP     211 - 279
//

Text Mined References (17)

PMID Year Title
26358398 2015 ODAM inhibits RhoA-dependent invasion in breast cancer.
25911094 2015 Odontogenic Ameloblast-associated Protein (ODAM) Mediates Junctional Epithelium Attachment to Teeth via Integrin-ODAM-Rho Guanine Nucleotide Exchange Factor 5 (ARHGEF5)-RhoA Signaling.
23648148 2013 Odontogenic ameloblast-associated protein (ODAM) inhibits growth and migration of human melanoma cells and elicits PTEN elevation and inactivation of PI3K/AKT signaling.
22387195 Expression pattern, subcellular localization, and functional implications of ODAM in ameloblasts, odontoblasts, osteoblasts, and various cancer cells.
20572917 2010 Disruption of periodontal integrity induces expression of apin by epithelial cell rests of Malassez.
18484335 2008 Odontogenic ameloblast-associated protein nature of the amyloid found in calcifying epithelial odontogenic tumors and unerupted tooth follicles.
18472969 Expression of odontogenic ameloblast-associated protein (ODAM) in dental and other epithelial neoplasms.
17647262 2008 Characterization of Apin, a secreted protein highly expressed in tooth-associated epithelia.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16674676 2006 Identification of secreted and membrane proteins in the rat incisor enamel organ using a signal-trap screening approach.
More...