Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.01
PubTator Score 3.22

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
26872154 Children with low 25-hydroxyvitamin D and TMEM16J rs7111432-AA or PKP3 rs10902158-GG polymorphisms were at increased risk for tuberculosis or death.
26317553 Suggest role for up-regulation of ANO9 in progression and metastasis of stage II and III colorectal carcinoma.
22223854 These results demonstrate a strong association of single-nucleotide polymorphisms in the PKP3-SIGIRR-TMEM16J gene region and tuberculosis in discovery and validation cohorts.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQGEESLRILVEPEGDSFPLMEISTCETEASEQWDYVLVAQRHTQRDPRQARQQQFLEELRRKGFHIKVI      1 - 70
RDQKQVFFGIRADNSVFGLYRTLLLEPEGPAPHAELAAPTTIPVTTSLRIRIVNFVVMNNKTSAGETFED     71 - 140
LMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIRNYFGEKVALYFVWLGWYTYMLVPAALTGLL    141 - 210
VFLSGFSLFEASQISKEICEAHDILMCPLGDHSRRYQRLSETCTFAKLTHLFDNDGTVVFAIFMALWATV    211 - 280
FLEIWKRQRARVVLHWDLYVWDEEQEEMALQLINCPDYKLRPYQHSYLRSTVILVLTLLMICLMIGMAHV    281 - 350
LVVYRVLASALFSSSAVPFLEEQVTTAVVVTGALVHYVTIIIMTKINRCVALKLCDFEMPRTFSERESRF    351 - 420
TIRFFTLQFFTHFSSLIYIAFILGRINGHPGKSTRLAGLWKLEECHASGCMMDLFVQMAIIMGLKQTLSN    421 - 490
CVEYLVPWVTHKCRSLRASESGHLPRDPELRDWRRNYLLNPVNTFSLFDEFMEMMIQYGFTTIFVAAFPL    491 - 560
APLLALFSNLVEIRLDAIKMVWLQRRLVPRKAKDIGTWLQVLETIGVLAVIANGMVIAFTSEFIPRVVYK    561 - 630
YRYSPCLKEGNSTVDCLKGYVNHSLSVFHTKDFQDPDGIEGSENVTLCRYRDYRNPPDYNFSEQFWFLLA    631 - 700
IRLAFVILFEHVALCIKLIAAWFVPDIPQSVKNKVLEVKYQRLREKMWHGRQRLGGVGAGSRPPMPAHPT    701 - 770
PASIFSARSTDV                                                              771 - 782
//

Text Mined References (21)

PMID Year Title
26872154 2016 Low Vitamin-D Levels Combined with PKP3-SIGIRR-TMEM16J Host Variants Is Associated with Tuberculosis and Death in HIV-Infected and -Exposed Infants.
26317553 2015 Identification and characterization of ANO9 in stage II and III colorectal carcinoma.
24692353 2014 Structure and function of TMEM16 proteins (anoctamins).
22946059 2012 Anoctamins are a family of Ca2+-activated Cl- channels.
22302790 2012 The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age.
22223854 2012 Common polymorphisms in the PKP3-SIGIRR-TMEM16J gene region are associated with susceptibility to tuberculosis.
22178883 2011 CFTR and TMEM16A are separate but functionally related Cl- channels.
21984732 2012 The anoctamin family: TMEM16A and TMEM16B as calcium-activated chloride channels.
21642943 2011 Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?
21607626 2011 Anoctamins.
More...