Property Summary

NCBI Gene PubMed Count 73
PubMed Score 103.72
PubTator Score 80.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (77)

AA Sequence

MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVK      1 - 70
ATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKK     71 - 140
FYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY                                 141 - 181
//

Text Mined References (75)

PMID Year Title