Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
adrenocortical carcinoma 1427 0.00215720476102823
adrenocortical adenoma 134 0.00442221512195531

Synonym

Accession A1A4T8 A8MYX4
Symbols C14orf182

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTGRMATLEKSHSSACWRKRSSRTCVEPDRTQDAIHEPRGLSRSHTVLRHRHFVFLPLSSGAHPSVPPRD      1 - 70
HFTHPFFASRVDGTVERGNPALWLCLSSPTGTRATKATKDPTLSSVQASQLEEARRQRPRGHQEAFEPAE     71 - 140
RAWEHNAERERIVP                                                            141 - 154
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.