Property Summary

NCBI Gene PubMed Count 3
Grant Count 9
R01 Count 9
Funding $569,391.06
PubMed Score 83.76
PubTator Score 21.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.400 0.005
ependymoma -1.700 0.002
oligodendroglioma -1.300 0.006
atypical teratoid / rhabdoid tumor -1.200 0.000
adult high grade glioma -1.200 0.000

AA Sequence

MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRLQATSHRKTSLPCPLPVLPRIPSSDCHPRRHS      1 - 70
HEDQEFRCRSHVRDYRKYSEDGSFKEPLESKGRSHSKIEKFSESFERQLCFRTKRSASLGPESRKERNER     71 - 140
ECLRMEIKSRKKVEEERSSRKEEHGEAHMAPLFEKGPE                                    141 - 178
//

Text Mined References (4)

PMID Year Title
16467868 2006 NUP98 rearrangements in hematopoietic malignancies: a study of the Groupe Francophone de Cytogénétique Hématologique.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.