Property Summary

NCBI Gene PubMed Count 3
PubMed Score 83.76
PubTator Score 21.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
adult high grade glioma 2148 3.07593999228311E-5
atypical teratoid / rhabdoid tumor 4369 3.27277191028681E-5
ependymoma 2514 0.00161236863268336
astrocytic glioma 2241 0.00486876998424391
oligodendroglioma 2849 0.00566386754462068

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.400 0.005
ependymoma -1.700 0.002
oligodendroglioma -1.300 0.006
atypical teratoid / rhabdoid tumor -1.200 0.000
adult high grade glioma -1.200 0.000

Synonym

Accession A1A4G5 B7ZLT3
Symbols NP3

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

AA Sequence

MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRLQATSHRKTSLPCPLPVLPRIPSSDCHPRRHS      1 - 70
HEDQEFRCRSHVRDYRKYSEDGSFKEPLESKGRSHSKIEKFSESFERQLCFRTKRSASLGPESRKERNER     71 - 140
ECLRMEIKSRKKVEEERSSRKEEHGEAHMAPLFEKGPE                                    141 - 178
//

Text Mined References (4)

PMID Year Title
16467868 2006 NUP98 rearrangements in hematopoietic malignancies: a study of the Groupe Francophone de Cytogénétique Hématologique.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.