Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.97
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Chondrosarcoma 21 3.162 1.6

Gene RIF (1)

AA Sequence

MEERAQHCLSRLLDNSALKQQELPIHRLYFTARRVLFVFFATGIFCLCMGIILILSARSTQEIEINYTRI      1 - 70
CANCAKLRENASNFDKECTCSIPFYLSGKMMVGEIQETRLTLH                                71 - 113
//

Text Mined References (3)

PMID Year Title