Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.85
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Chondrosarcoma 24 3.149 1.6

Gene RIF (1)

PMID Text
17258408 Elucidating the precise reproductive function of TMEM30C in mammals will be important to the foundation of divergence in higher primates at a molecular level.

AA Sequence

MEERAQHCLSRLLDNSALKQQELPIHRLYFTARRVLFVFFATGIFCLCMGIILILSARSTQEIEINYTRI      1 - 70
CANCAKLRENASNFDKECTCSIPFYLSGKMMVGEIQETRLTLH                                71 - 113
//

Text Mined References (3)

PMID Year Title
17258408 2007 Aberrant termination of reproduction-related TMEM30C transcripts in the hominoids.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15375526 2004 Identification and characterization of CDC50A, CDC50B and CDC50C genes in silico.