Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.43
PubTator Score 1.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
active ulcerative colitis -1.814 3.7e-04
psoriasis -1.100 2.5e-04

AA Sequence

MQLQVFWTGLEYTCRLLGITTAAVLIGVGTETFLQGQFKSLAFYLLFTGAAVSICEGAYFVAQLLAICFQ      1 - 70
CQPGSLADRVREKAHWLGCFQKFLAYLLLSVACFLHPVLVWHVTIPGSMLIITGLAYFLLSKRKKRKAAP     71 - 140
EVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSALQPPNTLMELSL    141 - 210
EPADSLAKKKQVHFEDNLVRIVPSLAEGLDDGDSEPEETTSDTTPIIPPPQAPLFLSSLTATGLF         211 - 275
//

Text Mined References (4)

PMID Year Title