Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.30
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.100 7.9e-03
medulloblastoma, large-cell 1.200 3.4e-04
osteosarcoma -1.160 4.8e-03
primary Sjogren syndrome -1.200 8.2e-04
subependymal giant cell astrocytoma -1.161 3.1e-02

Gene RIF (2)

AA Sequence

MSGQLERCEREWHELEGEFQELQETHRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASR      1 - 70
EEAELVQQMAANIKERQDVFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYLTIIL     71 - 140
LLGAVACRFVLHYRVTDEVFNFLLVWYYCTLTIRESILISNGSRIKGWWVSHHYVSTFLSGVMLTWPNGP    141 - 210
IYQKFRNQFLAFSIFQSCVQFLQYYYQRGCLYRLRALGERNHLDLTVEGFQSWMWRGLTFLLPFLFCGHF    211 - 280
WQLYNAVTLFELSSHEECREWQVFVLAFTFLILFLGNFLTTLKVVHAKLQKNRGKTKQP               281 - 339
//

Text Mined References (7)

PMID Year Title