Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.54
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.29063592324034E-14
ovarian cancer 8492 5.34088627691057E-7
Duchenne muscular dystrophy 602 6.90689728966325E-7
posterior fossa group A ependymoma 1511 1.72998881726874E-6
pituitary cancer 1972 6.34235278286954E-6
Amyotrophic Lateral Sclerosis 432 2.50649650874825E-4
acute quadriplegic myopathy 1157 0.00124874424477297
pediatric high grade glioma 2712 0.00133183633565934
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00144533921254234
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00179568563249856
Atopic dermatitis 944 0.00211579830068897
Pick disease 1893 0.00221688009900193
atypical teratoid / rhabdoid tumor 4369 0.00341649726674529
osteosarcoma 7933 0.00361236677337439
primary pancreatic ductal adenocarcinoma 1271 0.00568001771085809
glioblastoma 5572 0.00655216990972763
pancreatic cancer 2300 0.0114508389891686
active ulcerative colitis 477 0.0136772841278881
adrenocortical carcinoma 1427 0.0148348250215524
active Crohn's disease 918 0.0151591992648434
medulloblastoma 1524 0.0182806906747901
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.024569612040669
diabetes mellitus 1663 0.0274508964930271
subependymal giant cell astrocytoma 2287 0.0360235060065067
aldosterone-producing adenoma 664 0.0388010129621744

Expression

Synonym

Accession A0PJZ3
Symbols GLT8D4

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
19940119 We have identified two enzymes of the human glycosyltransferase 8 family, now named GXYLT1 and GXYLT2 (glucoside xylosyltransferase), as UDP-d-xylose:beta-d-glucoside alpha1,3-d-xylosyltransferases adding the first xylose.

AA Sequence

MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRR      1 - 70
RPPRPRPRAGRRGAARLEKLARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQ     71 - 140
FHIFTEDSLKPEFDKQLRQWPDSYTKKFEHRIYPITFSVGNPQEWKKLFKPCAAQRLFLPVILKDVDSLL    141 - 210
YVDTDVLFLRPVDDIWKLLRLFNSTQLAAMAPEHEIPKIGWYSRFARHPFYGSAGVNSGVMLMNLTRIRS    211 - 280
TQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQDLLNIIFYFNPECLYVFPCQWNYRPDHCMYGSNCRE    281 - 350
AEHEGVSVLHGNRGVYHDDKQPTFRALYEAIRDFPFQDNLFQSMYYPLQLKFLETVHTLCGRIPQVFLKQ    351 - 420
IEKTMKRAYEKHVIIHVGPNQMH                                                   421 - 443
//

Text Mined References (5)

PMID Year Title
23765671 2013 In vitro assays of orphan glycosyltransferases and their application to identify Notch xylosyltransferases.
19940119 2010 Identification of glycosyltransferase 8 family members as xylosyltransferases acting on O-glucosylated notch epidermal growth factor repeats.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.