Property Summary

NCBI Gene PubMed Count 7
Grant Count 28
R01 Count 13
Funding $2,551,594.56
PubMed Score 79.96
PubTator Score 91.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
26204995 SEZ6L, HISPPD1, FEZF1, SAMD11 gene variants may be associated with autism spectrum disorder.
25192046 Mutations in FEZF1 cause Kallmann syndrome.
24913420 Fezf1 and Fezf2 accomplish both independent and redundant functions across diverse tissue and cell types. [Review]
21170990 the aberrant expression of ZNF312b promotes gastric tumorigenesis through epigenetic modification of its promoter region and provides a molecular mechanism for ZNF312b expression to contribute to the progression of gastric cancer.
19401682 Observational study of gene-disease association. (HuGE Navigator)
19318583 Study is the first to report that ZNF312b, a novel transcription factor, was associated with tumorigenicity of gastric cancer.

AA Sequence

MDSSCHNATTKMLATAPARGNMMSTSKPLAFSIERIMARTPEPKALPVPHFLQGALPKGEPKHSLHLNSS      1 - 70
IPCMIPFVPVAYDTSPKAGVTGSEPRKASLEAPAAPAAVPSAPAFSCSDLLNCALSLKGDLARDALPLQQ     71 - 140
YKLVRPRVVNHSSFHAMGALCYLNRGDGPCHPAAGVNIHPVASYFLSSPLHPQPKTYLAERNKLVVPAVE    141 - 210
KYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKVFTCEVCGKVFNAHYNLTRHMP    211 - 280
VHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCG    281 - 350
KGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVR    351 - 420
KLHDSSLGLARTPAGEPGTEPPPPLPQQPPMTLPPLQPPLPTPGPLQPGLHQGHQ                   421 - 475
//

Text Mined References (10)

PMID Year Title
26204995 2015 Whole exome sequencing in extended families with autism spectrum disorder implicates four candidate genes.
25192046 2014 Mutations in FEZF1 cause Kallmann syndrome.
24913420 2014 Fez family transcription factors: controlling neurogenesis and cell fate in the developing mammalian nervous system.
21170990 2011 Human ZNF312b oncogene is regulated by Sp1 binding to its promoter region through DNA demethylation and histone acetylation in gastric cancer.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19318583 2009 Human ZNF312b promotes the progression of gastric cancer by transcriptional activation of the K-ras gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.