Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.08
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.5e-18
lung carcinoma 2843 1.4e-09
ovarian cancer 8520 6.4e-09
cystic fibrosis 1696 2.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.081 2.0e-04
lung carcinoma -1.300 1.4e-09
ovarian cancer -4.100 6.4e-09
psoriasis -1.200 2.5e-18

Gene RIF (2)

AA Sequence

MRALLALCLLLGWLRWGPAGAQQSGEYCHGWVDVQGNYHEGFQCPEDFDTLDATICCGSCALRYCCAAAD      1 - 70
ARLEQGGCTNDRRELEHPGITAQPVYVPFLIVGSIFIAFIILGSVVAIYCCTCLRPKEPSQQPIRFSLRS     71 - 140
YQTETLPMILTSTSPRAPSRQSSTATSSSSTGGSIRRFSFARAEPGCLVPSPPPPYTTSHSIHLAQPSGF    141 - 210
LVSPQYFAYPLQQEPPLPGKSCPDFSSS                                              211 - 238
//

Text Mined References (11)

PMID Year Title