Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.97
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.48153129695015E-18
lung carcinoma 2844 1.35088309057222E-9
ovarian cancer 8492 6.36368745757146E-9
cystic fibrosis 1670 2.04187592536909E-4

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.081 0.000
lung carcinoma -1.300 0.000
ovarian cancer -4.100 0.000
psoriasis -1.200 0.000

Synonym

Accession A0PJX4 A0PJX3 Q96EQ5
Symbols hShisa3

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
25968618 Down-regulation of SHISA3 expression was associated with colorectal cancer.

AA Sequence

MRALLALCLLLGWLRWGPAGAQQSGEYCHGWVDVQGNYHEGFQCPEDFDTLDATICCGSCALRYCCAAAD      1 - 70
ARLEQGGCTNDRRELEHPGITAQPVYVPFLIVGSIFIAFIILGSVVAIYCCTCLRPKEPSQQPIRFSLRS     71 - 140
YQTETLPMILTSTSPRAPSRQSSTATSSSSTGGSIRRFSFARAEPGCLVPSPPPPYTTSHSIHLAQPSGF    141 - 210
LVSPQYFAYPLQQEPPLPGKSCPDFSSS                                              211 - 238
//

Text Mined References (5)

PMID Year Title
25968618 2015 DNA Hypermethylation of SHISA3 in Colorectal Cancer: An Independent Predictor of Poor Prognosis.
25416956 2014 A proteome-scale map of the human interactome network.
17481602 2007 Mouse homologues of Shisa antagonistic to Wnt and Fgf signalings.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.