Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.97
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.081 0.000
lung carcinoma -1.300 0.000
ovarian cancer -4.100 0.000
psoriasis -1.200 0.000

Synonym

Accession A0PJX4 A0PJX3 Q96EQ5
Symbols hShisa3

Gene

Gene RIF (1)

PMID Text
25968618 Down-regulation of SHISA3 expression was associated with colorectal cancer.

AA Sequence

MRALLALCLLLGWLRWGPAGAQQSGEYCHGWVDVQGNYHEGFQCPEDFDTLDATICCGSCALRYCCAAAD      1 - 70
ARLEQGGCTNDRRELEHPGITAQPVYVPFLIVGSIFIAFIILGSVVAIYCCTCLRPKEPSQQPIRFSLRS     71 - 140
YQTETLPMILTSTSPRAPSRQSSTATSSSSTGGSIRRFSFARAEPGCLVPSPPPPYTTSHSIHLAQPSGF    141 - 210
LVSPQYFAYPLQQEPPLPGKSCPDFSSS                                              211 - 238
//

Text Mined References (5)

PMID Year Title
25968618 2015 DNA Hypermethylation of SHISA3 in Colorectal Cancer: An Independent Predictor of Poor Prognosis.
25416956 2014 A proteome-scale map of the human interactome network.
17481602 2007 Mouse homologues of Shisa antagonistic to Wnt and Fgf signalings.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.