Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.59
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 0.000

Gene RIF (2)

PMID Text
22779914 CIB4, as binding partners for the integrin alphaIIb subunit, which suggests that they are potentially involved in regulating integrin alphaIIb subunit activation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRI      1 - 70
CRVFSHKGMFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLL     71 - 140
MDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC                             141 - 185
//

Text Mined References (6)

PMID Year Title
22779914 2012 Biophysical and structural studies of the human calcium- and integrin-binding protein family: understanding their functional similarities and differences.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15574431 2005 Structural and biochemical characterization of CIB1 delineates a new family of EF-hand-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.