Calcium and integrin-binding family member 4

Property Summary

NCBI Gene PubMed Count	5
PubMed Score	3.28

PubTator Score	0.67

Knowledge Summary

Patent

No data available

TINX Plot

Disease (2)

Expression Atlas
JensenLab Text Mining

Disease	Target Count	P-value
ovarian cancer	8520	5.6e-09

Disease	Target Count	Z-score	Confidence
Usher syndrome type 1	10	3.684	1.8

Expression

Specificity
Differential

Differential Expression (1)

Disease	log2 FC	p
ovarian cancer	1.100	5.6e-09

Testis 18,518

Adrenal Gland 18,071

Thyroid 18,024

Artery - Coronary 17,949

Lung 18,057

Artery - Tibial 17,631

Brain - Cerebellum 17,983

Brain - Cerebellar Hemisphere 18,015

Stomach 17,879

Artery - Aorta 17,896

Small Intestine - Terminal Ileum 17,954

Prostate 18,213

Pituitary 18,147

Colon - Sigmoid 18,089

Brain - Hypothalamus 18,169

Pancreas 18,123

Esophagus - Gastroesophageal Junction 18,000

Esophagus - Muscularis 18,017

Vagina 17,834

Adipose - Subcutaneous 18,110

Brain - Cortex 18,039

Brain - Frontal Cortex (BA9) 18,069

Brain - Anterior cingulate cortex (BA24) 17,989

Nerve - Tibial 18,007

Ovary 17,971

Adipose - Visceral (Omentum) 17,937

Breast - Mammary Tissue 18,103

Heart - Atrial Appendage 17,896

Liver 18,071

Skin - Not Sun Exposed (Suprapubic) 18,081

Spleen 17,614

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Amygdala 18,006

Brain - Caudate (basal ganglia) 18,001

Brain - Putamen (basal ganglia) 17,863

Brain - Spinal cord (cervical c-1) 17,973

Skin - Sun Exposed (Lower leg) 17,968

Esophagus - Mucosa 18,076

Kidney - Cortex 17,329

Colon - Transverse 17,825

Uterus 17,618

Minor Salivary Gland 18,005

Cells - EBV-transformed lymphocytes 18,186

Brain - Hippocampus 18,011

Heart - Left Ventricle 18,006

Brain - Substantia nigra 17,981

Muscle - Skeletal 17,778

NK Cells 8,475

adipose tissue 15,837

adrenal gland 15,963

endometrium 16,349

kidney 15,917

lung 16,312

placenta 15,937

prostate 16,460

seminal vesicle 15,918

smooth muscle 15,857

testis 17,936

thyroid gland 15,959

Urinary Tract 16,678

Endocrine System 18,159

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Testis 3,897

See source...

i10 7

Cochlear hair cell 42

See source...

Synonym

Accession	A0PJX0 B2RU18
Symbols	KIP4

Gene

CIB4

Ortholog (10)

Species	Source	Disease
Chimp 14,140	OMA EggNOG
Macaque 12,761	Inparanoid OMA EggNOG
Mouse 16,570	Inparanoid OMA EggNOG
Rat 15,117	Inparanoid OMA EggNOG
Dog 15,073	Inparanoid OMA EggNOG
Horse 14,252	Inparanoid OMA EggNOG
Cow 15,320	Inparanoid OMA EggNOG
Pig 10,168	OMA EggNOG
Opossum 12,230	Inparanoid EggNOG
Platypus 5,703	Inparanoid OMA EggNOG

UniProt Keyword (7)

Complete proteome 20,231

Metal-binding 3,672

Polymorphism 12,194

Reference proteome 20,231

Repeat 4,916

Calcium 875

Magnesium 558

GO Function (2)

calcium ion binding 690

magnesium ion binding 197

Compartment GO Term (0)

GWAS Trait (1)

Post bronchodilator FEV1 173

HCA RNA Cell Line (6)

A-431 16,131

CAPAN-2 16,102

EFO-21 17,301

HeLa 15,690

NTERA-2 17,039

SCLC-21H 17,139

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRI      1 - 70
CRVFSHKGMFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLL     71 - 140
MDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC                             141 - 185
//

Text Mined References (6)

Summary
Details

	PMID	Year	Title