Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.28
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 5.6e-09
Disease Target Count Z-score Confidence
Usher syndrome type 1 10 3.684 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 5.6e-09

Gene RIF (2)

AA Sequence

MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRI      1 - 70
CRVFSHKGMFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLL     71 - 140
MDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC                             141 - 185
//

Text Mined References (6)

PMID Year Title