Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.32
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Obesity 616
Disease Target Count P-value
lung carcinoma 2844 9.99079399073343E-45
non-small cell lung cancer 2798 8.54967070212138E-9
pituitary cancer 1972 3.66879483126394E-6
adrenocortical carcinoma 1427 5.82990561596148E-6
sonic hedgehog group medulloblastoma 1482 1.18726110887152E-4
interstitial cystitis 2299 2.99801135664631E-4
subependymal giant cell astrocytoma 2287 9.64270084714121E-4
head and neck cancer 270 0.00179367054967785
cystic fibrosis 1670 0.00399746708235389
glioblastoma 5572 0.00508773537924311
non-inflammatory breast cancer 208 0.00718821642963845
fibroadenoma 557 0.0246810906334432
head and neck cancer and chronic obstructive pulmonary disease 237 0.024695993339942
ovarian cancer 8492 0.0315514632566902
Disease Target Count Z-score Confidence
Parkinson's disease 364 0.0 1.0
Disease Target Count Z-score Confidence
Endometritis 21 3.093 1.5

Expression

  Differential Expression (14)

Synonym

Accession A0PJW8 A0PJW9 B9EIK6
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Gene RIF (2)

PMID Text
25680934 DAPL1 plays a role in epithelial differentiation and may be involved in apoptotic processes thereby suggesting a possible novel pathway in AMD pathogenesis.
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MANEVQDLLSPRKGGHPPAVKAGGMRISKKQEIGTLERHTKKTGFEKTSAIANVAKIQTLDALNDALEKL      1 - 70
NYKFPATVHMAHQKPTPALEKVVPLKRIYIIQQPRKC                                      71 - 107
//

Text Mined References (7)

PMID Year Title
25680934 2015 A Candidate Gene Association Study Identifies DAPL1 as a Female-Specific Susceptibility Locus for Age-Related Macular Degeneration (AMD).
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
15920738 2006 EEDA: a protein associated with an early stage of stratified epithelial differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.