Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.29
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -4.176 5.8e-06
cystic fibrosis -2.700 4.0e-03
fibroadenoma 1.400 2.5e-02
glioblastoma 1.700 5.1e-03
head and neck cancer -2.400 1.8e-03
head and neck cancer and chronic obstruc... -1.300 2.5e-02
inflammatory breast cancer -2.200 2.3e-03
interstitial cystitis -2.800 2.4e-03
lung carcinoma 3.600 1.0e-44
medulloblastoma 1.300 3.7e-02
non-small cell lung cancer 3.061 8.5e-09
ovarian cancer 1.600 3.2e-02
pituitary cancer 2.700 3.7e-06
subependymal giant cell astrocytoma 5.367 9.6e-04

Gene RIF (3)

AA Sequence

MANEVQDLLSPRKGGHPPAVKAGGMRISKKQEIGTLERHTKKTGFEKTSAIANVAKIQTLDALNDALEKL      1 - 70
NYKFPATVHMAHQKPTPALEKVVPLKRIYIIQQPRKC                                      71 - 107
//

Text Mined References (8)

PMID Year Title