Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A0PJE2 Q96GB2 Q9H8H1
Symbols SDR40C1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSLYRSVVWFAKGLREYTKSGYESACKDFVPHDLEVQIPGRVFLVTGGNSGIGKATALEIAKRGGTVHLV      1 - 70
CRDQAPAEDARGEIIRESGNQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGL     71 - 140
EKNFAANTLGVYILTTGLIPVLEKEHDPRVITVSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVV    141 - 210
LTERWAQGHPAIHFSSMHPGWADTPGVRQAMPGFHARFGDRLRSEAQGADTMLWLALSSAAAAQPSGRFF    211 - 280
QDRKPVSTHLPLATASSSPAEEEKLIEILEQLAQTFK                                     281 - 317
//

Text Mined References (6)

PMID Year Title