Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.81
PubTator Score 8.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.100 0.049
ependymoma -2.300 0.027
glioblastoma -2.100 0.007
oligodendroglioma -1.500 0.000
sonic hedgehog group medulloblastoma -1.500 0.014
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -1.700 0.001
tuberculosis 1.500 0.000
lung cancer 1.900 0.000
pediatric high grade glioma -1.900 0.001
invasive ductal carcinoma 1.400 0.004
mucosa-associated lymphoid tissue lympho... 1.428 0.044
acute myeloid leukemia -1.600 0.015
ovarian cancer 1.900 0.000

Gene RIF (3)

PMID Text
26293343 Rnaset2 inhibits melanocyte outgrowth through interacting with shootin1, and this effect may be associated with vitiligo pathogenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNSSDEEKQLQLITSLKEQAIGEYEDLRAENQKTKEKCDKIRQERDEAVKKLEEFQKISHMVIEEVNFMQ      1 - 70
NHLEIEKTCRESAEALATKLNKENKTLKRISMLYMAKLGPDVITEEINIDDEDSTTDTDGAAETCVSVQC     71 - 140
QKQIKELRDQIVSVQEEKKILAIELENLKSKLVEVIEEVNKVKQEKTVLNSEVLEQRKVLEKCNRVSMLA    141 - 210
VEEYEEMQVNLELEKDLRKKAESFAQEMFIEQNKLKRQSHLLLQSSIPDQQLLKALDENAKLTQQLEEER    211 - 280
IQHQQKVKELEEQLENETLHKEIHNLKQQLELLEEDKKELELKYQNSEEKARNLKHSVDELQKRVNQSEN    281 - 350
SVPPPPPPPPPLPPPPPNPIRSLMSMIRKRSHPSGSGAKKEKATQPETTEEVTDLKRQAVEEMMDRIKKG    351 - 420
VHLRPVNQTARPKTKPESSKGCESAVDELKGILGTLNKSTSSRSLKSLDPENSETELERILRRRKVTAEA    421 - 490
DSSSPTGILATSESKSMPVLGSVSSVTKTALNKKTLEAEFNSPSPPTPEPGEGPRKLEGCTSSKVTFQPP    491 - 560
SSIGCRKKYIDGEKQAEPVVVLDPVSTHEPQTKDQVAEKDPTQHKEDEGEIQPENKEDSIENVRETDSSN    561 - 630
C//

Text Mined References (28)

PMID Year Title
27177867 2016 Identification of a shootin1 isoform expressed in peripheral tissues.
26293343 2015 Rnaset2 inhibits melanocyte outgrowth possibly through interacting with shootin1.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23864681 2013 Shootin1 acts in concert with KIF20B to promote polarization of migrating neurons.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22863734 2012 Genome-wide meta-analyses of nonsyndromic cleft lip with or without cleft palate identify six new risk loci.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...