Property Summary

NCBI Gene PubMed Count 31
PubMed Score 71.36
PubTator Score 29.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 1.1e-03
Breast cancer 3577 4.7e-02
Disease Target Count Z-score Confidence
Breast lipoma 1 5.59 2.8
NGLY1-deficiency 4 4.09 2.0
Biotinidase deficiency 14 3.13 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 2.100 4.7e-02
lung adenocarcinoma 1.200 1.1e-03

 GWAS Trait (1)

Gene RIF (23)

AA Sequence

MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRE      1 - 70
LPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSS     71 - 140
FNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPD    141 - 210
RKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR                                        211 - 244
//

Text Mined References (38)

PMID Year Title