Property Summary

NCBI Gene PubMed Count 27
PubMed Score 49.72
PubTator Score 29.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 2.100 0.047
lung adenocarcinoma 1.200 0.001

Synonym

Accession A0JLT2 Q8IV02 Q8IZD1
Symbols LCMR1
DT2P1G7
MED19AS

Gene

Gene RIF (19)

PMID Text
25735376 High expression of Med19 is associated with cisplatin resistance in non-small cell lung cancer cells.
24565852 Data show that the expression of Mediator of RNA polymerase II transcription subunit 19 (Med19) was increased in Osteosarcoma (OS) samples from patients compared to normal bone tissues.
23705783 High Med19 expression is associated with tongue cancer.
23276457 Med19 promotes bone metastasis and invasiveness of bladder urothelial carcinoma via bone morphogenetic protein 2.
23098456 High MED19 expression is associated with lung adenocarcinoma cell clone conformation, growth, and metastasis.
23076562 LCMR1 suppresses apoptosis in lung cancer cells and this effect is associated with multiple apoptosis-related proteins, including p53, Bax and Mcl-1.
22565189 Med19 functions in promoting cellular growth and may be a useful therapeutic target in malignant gastric carcinoma
21871180 MED19 serves as a novel proliferation regulator that promotes growth of prostate cancer cells.
21732059 The effect of downregulation of LCMR1 by lentivirus-mediated small hairpin RNA (shRNA) on colorectal cancer cell proliferation and tumorigenesis was explored.
21542455 MED19 played an important role in cell growth and cell cycle progression of human osteosarcoma cells.
More...

AA Sequence

MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRE      1 - 70
LPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSS     71 - 140
FNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPD    141 - 210
RKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR                                        211 - 244
//

Text Mined References (34)

PMID Year Title
25735376 2015 Knockdown of Med19 suppresses proliferation and enhances chemo-sensitivity to cisplatin in non-small cell lung cancer cells.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
24565852 2014 Mediator of RNA polymerase II transcription subunit 19 promotes osteosarcoma growth and metastasis and associates with prognosis.
23705783 2013 Disruption of mediator complex subunit 19 (Med19) inhibits cell growth and migration in tongue cancer.
23276457 2013 Med19 promotes bone metastasis and invasiveness of bladder urothelial carcinoma via bone morphogenetic protein 2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23098456 2012 Mammalian mediator 19 mediates H1299 lung adenocarcinoma cell clone conformation, growth, and metastasis.
23076562 2012 Suppression of lung cancer metastasis-related protein 1 promotes apoptosis in lung cancer cells.
22565189 2012 Med19 promotes gastric cancer progression and cellular growth.
More...