Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.71
PubTator Score 3.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.606 0.002
posterior fossa group A ependymoma -1.400 0.000
group 3 medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.100 0.001
glioblastoma -1.100 0.006
primitive neuroectodermal tumor -1.400 0.001
non-small cell lung cancer -1.426 0.000
lung adenocarcinoma -1.500 0.000
pediatric high grade glioma -1.100 0.000
psoriasis 1.800 0.000

Synonym

Accession A0FGR9 A8K0G5 Q6ZV21 Q8NDZ5 Q9BQR9 E-Syt3
Symbols E-Syt3
FAM62C
CHR3SYT

Gene

 GO Process (1)

Gene RIF (3)

PMID Text
25922075 ESyt2 and ESyt3, but not ESyt1, interact with activated FGFR1.
23791178 The extended synaptotagmins (E-Syt1, E-Syt2, and E-Syt3) are endoplasmic reticulum-anchored proteins. They form homo- and heteromeric complexes that mediate contacts with the plasma membrane. Such contacts are critically dependent on the presence of PI(4,5)P2 in this membrane and are additionally regulated by cytosolic Ca2+ via the Ca2+-sensing property of E-Syt1.
21733517 two haplotype blocks of ESYT3 gene in 3q22.3 region that likely harbor functional variants and have a role in coronary artery disease in females

AA Sequence

MRAEEPCAPGAPSALGAQRTPGPELRLSSQLLPELCTFVVRVLFYLGPVYLAGYLGLSITWLLLGALLWM      1 - 70
WWRRNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANKIISQTWPYLSMIMESKF     71 - 140
REKLEPKIREKSIHLRTFTFTKLYFGQKCPRVNGVKAHTNTCNRRRVTVDLQICYIGDCEISVELQKIQA    141 - 210
GVNGIQLQGTLRVILEPLLVDKPFVGAVTVFFLQKPHLQINWTGLTNLLDAPGINDVSDSLLEDLIATHL    211 - 280
VLPNRVTVPVKKGLDLTNLRFPLPCGVIRVHLLEAEQLAQKDNFLGLRGKSDPYAKVSIGLQHFRSRTIY    281 - 350
RNLNPTWNEVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWFVLNDTTSGRLHL    351 - 420
RLEWLSLLTDQEVLTEDHGGLSTAILVVFLESACNLPRNPFDYLNGEYRAKKLSRFARNKVSKDPSSYVK    421 - 490
LSVGKKTHTSKTCPHNKDPVWSQVFSFFVHNVATERLHLKVLDDDQECALGMLEVPLCQILPYADLTLEQ    491 - 560
RFQLDHSGLDSLISMRLVLRFLQVEERELGSPYTGPEALKKGPLLIKKVATNQGPKAQPQEEGPTDLPCP    561 - 630
PDPASDTKDVSRSTTTTTSATTVATEPTSQETGPEPKGKDSAKRFCEPIGEKKSPATIFLTVPGPHSPGP    631 - 700
IKSPRPMKCPASPFAWPPKRLAPSMSSLNSLASSCFDLADISLNIEGGDLRRRQLGEIQLTVRYVCLRRC    701 - 770
LSVLINGCRNLTPCTSSGADPYVRVYLLPERKWACRKKTSVKRKTLEPLFDETFEFFVPMEEVKKRSLDV    771 - 840
AVKNSRPLGSHRRKELGKVLIDLSKEDLIKGFSQWYELTPNGQPRS                            841 - 886
//

Text Mined References (13)

PMID Year Title
25922075 2015 Extended Synaptotagmin Interaction with the Fibroblast Growth Factor Receptor Depends on Receptor Conformation, Not Catalytic Activity.
23791178 2013 PI(4,5)P(2)-dependent and Ca(2+)-regulated ER-PM interactions mediated by the extended synaptotagmins.
21733517 2011 Fine mapping of chromosome 3q22.3 identifies two haplotype blocks in ESYT3 associated with coronary artery disease in female Han Chinese.
17672888 2007 Evolutionary genomics of plant genes encoding N-terminal-TM-C2 domain proteins and the similar FAM62 genes and synaptotagmin genes of metazoans.
17360437 2007 E-Syts, a family of membranous Ca2+-sensor proteins with multiple C2 domains.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15238157 2004 Synaptotagmin gene content of the sequenced genomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...