Property Summary

NCBI Gene PubMed Count 17
PubMed Score 13.48
PubTator Score 7.27

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A0FGR8 A4D229 Q69YJ2 Q6UKI4 Q6ZTU0 Q6ZVU1 Q9BQS0 Q9NW47 Q9ULJ2 E-Syt2
Symbols E-Syt2
FAM62B
CHR2SYT

Gene

PDB

2DMG   4NPJ   4NPK   4P42  

Gene RIF (3)

PMID Text
25922075 ESyt2 and ESyt3, but not ESyt1, interact with activated FGFR1.
24847877 2.44 A resolution the crystal structure of a fragment of extended synaptotagmin 2, including an SMP domain and two adjacent C2 domains; evidence for a role of SMP-domain-containing proteins in the control of lipid transfer at membrane contact sites
23791178 The extended synaptotagmins (E-Syt1, E-Syt2, and E-Syt3) are endoplasmic reticulum-anchored proteins. They form homo- and heteromeric complexes that mediate contacts with the plasma membrane. Such contacts are critically dependent on the presence of PI(4,5)P2 in this membrane and are additionally regulated by cytosolic Ca2+ via the Ca2+-sensing property of E-Syt1.

AA Sequence

MTANRDAALSSHRHPGCAQRPRTPTFASSSQRRSAFGFDDGNFPGLGERSHAPGSRLGARRRAKTARGLR      1 - 70
GHRQRGAGAGLSRPGSARAPSPPRPGGPENPGGVLSVELPGLLAQLARSFALLLPVYALGYLGLSFSWVL     71 - 140
LALALLAWCRRSRGLKALRLCRALALLEDEERVVRLGVRACDLPAWVHFPDTERAEWLNKTVKHMWPFIC    141 - 210
QFIEKLFRETIEPAVRGANTHLSTFSFTKVDVGQQPLRINGVKVYTENVDKRQIILDLQISFVGNCEIDL    211 - 280
EIKRYFCRAGVKSIQIHGTMRVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLTNLLDVPGLNGLSDTI    281 - 350
ILDIISNYLVLPNRITVPLVSEVQIAQLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRV    351 - 420
GNQIFQSRVIKENLSPKWNEVYEALVYEHPGQELEIELFDEDPDKDDFLGSLMIDLIEVEKERLLDEWFT    421 - 490
LDEVPKGKLHLRLEWLTLMPNASNLDKVLTDIKADKDQANDGLSSALLILYLDSARNLPSGKKISSNPNP    491 - 560
VVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMT    561 - 630
VSQRFQLSNSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSN    631 - 700
TAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRSSSSLLASPGHISVKEPTPSIASDISLPIATQELR    701 - 770
QRLRQLENGTTLGQSPLGQIQLTIRHSSQRNKLIVVVHACRNLIAFSEDGSDPYVRMYLLPDKRRSGRRK    771 - 840
THVSKKTLNPVFDQSFDFSVSLPEVQRRTLDVAVKNSGGFLSKDKGLLGKVLVALASEELAKGWTQWYDL    841 - 910
TEDGTRPQAMT                                                               911 - 921
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25922075 2015 Extended Synaptotagmin Interaction with the Fibroblast Growth Factor Receptor Depends on Receptor Conformation, Not Catalytic Activity.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24847877 2014 Structure of a lipid-bound extended synaptotagmin indicates a role in lipid transfer.
24373768 2014 Structure and Ca²?-binding properties of the tandem C? domains of E-Syt2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23791178 2013 PI(4,5)P(2)-dependent and Ca(2+)-regulated ER-PM interactions mediated by the extended synaptotagmins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...