Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.40
PubTator Score 7.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.735 4.7e-06
aldosterone-producing adenoma -1.850 3.6e-02
atypical teratoid / rhabdoid tumor -1.200 3.0e-03
cystic fibrosis -1.124 1.8e-03
ependymoma 1.500 2.0e-03
fascioscapulohumeral muscular dystrophy 1.165 4.0e-05
gastric carcinoma 1.100 1.4e-02
glioblastoma 1.600 2.7e-02
group 4 medulloblastoma 2.100 4.3e-03
invasive ductal carcinoma 1.100 2.2e-03
juvenile dermatomyositis 1.368 1.0e-10
medulloblastoma, large-cell 1.300 1.6e-03
non-small cell lung cancer 1.116 4.5e-15
oligodendroglioma 1.200 1.4e-02
osteosarcoma 2.751 1.5e-04
ovarian cancer -1.100 1.8e-03
pancreatic cancer -1.600 1.9e-02
pancreatic carcinoma -1.600 1.9e-02
pediatric high grade glioma 1.200 3.9e-02
primary pancreatic ductal adenocarcinoma 1.572 8.0e-03

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MTANRDAALSSHRHPGCAQRPRTPTFASSSQRRSAFGFDDGNFPGLGERSHAPGSRLGARRRAKTARGLR      1 - 70
GHRQRGAGAGLSRPGSARAPSPPRPGGPENPGGVLSVELPGLLAQLARSFALLLPVYALGYLGLSFSWVL     71 - 140
LALALLAWCRRSRGLKALRLCRALALLEDEERVVRLGVRACDLPAWVHFPDTERAEWLNKTVKHMWPFIC    141 - 210
QFIEKLFRETIEPAVRGANTHLSTFSFTKVDVGQQPLRINGVKVYTENVDKRQIILDLQISFVGNCEIDL    211 - 280
EIKRYFCRAGVKSIQIHGTMRVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLTNLLDVPGLNGLSDTI    281 - 350
ILDIISNYLVLPNRITVPLVSEVQIAQLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRV    351 - 420
GNQIFQSRVIKENLSPKWNEVYEALVYEHPGQELEIELFDEDPDKDDFLGSLMIDLIEVEKERLLDEWFT    421 - 490
LDEVPKGKLHLRLEWLTLMPNASNLDKVLTDIKADKDQANDGLSSALLILYLDSARNLPSGKKISSNPNP    491 - 560
VVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMT    561 - 630
VSQRFQLSNSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSN    631 - 700
TAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRSSSSLLASPGHISVKEPTPSIASDISLPIATQELR    701 - 770
QRLRQLENGTTLGQSPLGQIQLTIRHSSQRNKLIVVVHACRNLIAFSEDGSDPYVRMYLLPDKRRSGRRK    771 - 840
THVSKKTLNPVFDQSFDFSVSLPEVQRRTLDVAVKNSGGFLSKDKGLLGKVLVALASEELAKGWTQWYDL    841 - 910
TEDGTRPQAMT                                                               911 - 921
//

Text Mined References (31)

PMID Year Title