Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 2.86295784611422E-15
lung adenocarcinoma 2714 8.92528375614929E-15
Breast cancer 3099 3.42883843680733E-9
ependymoma 2514 2.40230774886724E-7
ovarian cancer 8492 2.46454777122035E-7
pilocytic astrocytoma 3086 6.49743820490931E-5
osteosarcoma 7933 7.44994426310809E-5
group 4 medulloblastoma 1875 1.01996248556851E-4
psoriasis 6685 4.40939974683033E-4
primitive neuroectodermal tumor 3031 0.00883664489201796
urothelial carcinoma 318 0.0121196429555346
spina bifida 1064 0.0194703477480473
active Crohn's disease 918 0.0375377947431143

Expression

  Differential Expression (13)

Disease log2 FC p
urothelial carcinoma -1.300 0.012
psoriasis -1.700 0.000
osteosarcoma -1.736 0.000
ependymoma 1.300 0.000
group 4 medulloblastoma 1.900 0.000
primitive neuroectodermal tumor 1.200 0.009
non-small cell lung cancer -1.298 0.000
active Crohn's disease 1.580 0.038
lung adenocarcinoma -1.100 0.000
pilocytic astrocytoma 1.500 0.000
spina bifida -1.538 0.019
Breast cancer -1.500 0.000
ovarian cancer -1.500 0.000

Synonym

Accession A0AUZ9 B7ZLN1 I6L9A8 Q53TV8 Q53TW3 Q6IS05 Q8TCI1 Q96MI0 Q9UFC3
Symbols MSL1v2
C2orf67

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGS      1 - 70
PQSSKHYQTVFLMRSNSTLNKHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSHSEEFIKKEPLSD     71 - 140
TTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALLDKVTDAEIKKGLLHCTQKKIVPGHSNVPVS    141 - 210
SSAAEKEEEVHARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKLSMKHQLPKMKTFHEPTT    211 - 280
ILGNSLPKCTEIKPEVNTLTAENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDD    281 - 350
DLDEYTLRKNVAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKGIVVLEECQL    351 - 420
PKDILKKQMQFADQAASLNILGNPQVPQECQDPVPEQDFEMSPSSPTLLLRNIEKQSAQLTEIINSLIAP    421 - 490
LNLSPTSSPLSSKSCSHKCLANGIYRSASENLDELSSSSSWLLNQKHSKKKRKDRTRLKSSSLTFMSTSA    491 - 560
RTRPLQSFHKRKLYRLSPTFYWTPQTLPSKETAFLNTTQMPCLQSASTWSSYEHNSESYLLREHVSELDS    561 - 630
SFHSVLSLPSDVPLHFHFETLLKKTEIKGNLAENKFVDEYIISPSPVHSTLNQWRNGYSPICKPQIRSES    631 - 700
SAQLLQGRKKRHLSETALGERTKLEESDFQHTESGSHSNFTAVSNVNVLSRIQNSSRNTARRRLRSESSY    701 - 770
DIDNIVIPMSLVAPAKLEKLQYKEILTPSWRMVVLQPLDEYNLGKEEIEDLSDEVFSLRHKKYEEREQAR    771 - 840
WSLWEQSKWHRRNSRAYSKNVEGQDLLLKEYPNNFSSSQQCAAASPPGLPSENQDLCAYGLPSLNQSQET    841 - 910
KSLWWERRAFPLKGEDMAALLCQDEKKDQVERSSTAFHGEIFGTSVPENGHHPKKQSDGMEEYKTFGLGL    911 - 980
TNVKKNR                                                                   981 - 987
//

Text Mined References (10)

PMID Year Title
24145748 2013 DNA damage induced MutS homologue hMSH4 acetylation.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16227571 2005 A human protein complex homologous to the Drosophila MSL complex is responsible for the majority of histone H4 acetylation at lysine 16.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.