Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.41

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.021 2.1e-02
Astrocytoma, Pilocytic 1.500 7.3e-05
Breast cancer -1.500 3.4e-09
ependymoma 1.300 2.4e-07
group 3 medulloblastoma 1.300 4.2e-02
lung adenocarcinoma -1.100 8.9e-15
non-small cell lung cancer -1.298 2.9e-15
osteosarcoma -1.014 1.9e-04
ovarian cancer -1.500 2.5e-07
primitive neuroectodermal tumor 1.200 8.8e-03
psoriasis -1.700 4.4e-04
spina bifida -1.538 1.9e-02
urothelial carcinoma -1.300 1.2e-02

 Compartment GO Term (1)

AA Sequence

MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGS      1 - 70
PQSSKHYQTVFLMRSNSTLNKHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSHSEEFIKKEPLSD     71 - 140
TTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALLDKVTDAEIKKGLLHCTQKKIVPGHSNVPVS    141 - 210
SSAAEKEEEVHARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKLSMKHQLPKMKTFHEPTT    211 - 280
ILGNSLPKCTEIKPEVNTLTAENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDD    281 - 350
DLDEYTLRKNVAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKGIVVLEECQL    351 - 420
PKDILKKQMQFADQAASLNILGNPQVPQECQDPVPEQDFEMSPSSPTLLLRNIEKQSAQLTEIINSLIAP    421 - 490
LNLSPTSSPLSSKSCSHKCLANGIYRSASENLDELSSSSSWLLNQKHSKKKRKDRTRLKSSSLTFMSTSA    491 - 560
RTRPLQSFHKRKLYRLSPTFYWTPQTLPSKETAFLNTTQMPCLQSASTWSSYEHNSESYLLREHVSELDS    561 - 630
SFHSVLSLPSDVPLHFHFETLLKKTEIKGNLAENKFVDEYIISPSPVHSTLNQWRNGYSPICKPQIRSES    631 - 700
SAQLLQGRKKRHLSETALGERTKLEESDFQHTESGSHSNFTAVSNVNVLSRIQNSSRNTARRRLRSESSY    701 - 770
DIDNIVIPMSLVAPAKLEKLQYKEILTPSWRMVVLQPLDEYNLGKEEIEDLSDEVFSLRHKKYEEREQAR    771 - 840
WSLWEQSKWHRRNSRAYSKNVEGQDLLLKEYPNNFSSSQQCAAASPPGLPSENQDLCAYGLPSLNQSQET    841 - 910
KSLWWERRAFPLKGEDMAALLCQDEKKDQVERSSTAFHGEIFGTSVPENGHHPKKQSDGMEEYKTFGLGL    911 - 980
TNVKKNR                                                                   981 - 987
//

Text Mined References (11)

PMID Year Title