Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 0.000

Synonym

Accession A0A5B9
Symbols TCRBC2

Gene

PDB

3KXF   4P4K   5BS0   4WW2   4WWK   5EU6   5HYJ   1AO7   1BD2   2BNQ   4ZEZ   5C07   5C08   5C09   5C0A   5C0B   5C0C   5HHM   5HHO   2EYR   2EYS   2EYT   3O6F   3O8X   3O9W   3QUX   3T0E   3TA3   3TVM   4C56   4MVB   4MXQ   4N0C   4N5E   4NHU   4ONH   4UDT   4UDU   4WW1   4Y16   4Y2D   4Y4F   4Y4H   4Y4K   4ZAK   5BRZ   5FK9   5FKA  

 Compartment GO Term (0)

AA Sequence

DLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALND      1 - 70
SRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQG     71 - 140
VLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG                                    141 - 178
//

Text Mined References (3)

PMID Year Title
8951372 1996 Sequence and evolution of the human germline V lambda repertoire.
8650574 1996 The complete 685-kilobase DNA sequence of the human beta T cell receptor locus.
3860845 1985 Sequence and evolution of the human T-cell antigen receptor beta-chain genes.