Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.06
PubTator Score 0.05

Knowledge Summary

Patent

No data available

Synonym

Accession A0A183
Symbols C1orf44

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTY      1 - 70
HCKEEECEGD                                                                 71 - 80
//

Text Mined References (4)

PMID Year Title