Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.06
PubTator Score 0.05

Knowledge Summary

Patent

No data available

Synonym

Accession A0A183
Symbols C1orf44

Gene

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
15854049 Describes neighboring LCE family members that are present in the same cluster on chromosome 1q21.

AA Sequence

MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTY      1 - 70
HCKEEECEGD                                                                 71 - 80
//

Text Mined References (4)

PMID Year Title
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15854049 2005 Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.