Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A0A0J9YWL9
Symbols

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MAMNFGDHASGFRHDDVIRFINNEVLRNGGSPAFYTAFRSRPWNEVEDRLRAIVADPRVPRAIKRACTWS      1 - 70
ALALSVQVAARQQEELLYQVWWLQGHVEECQATSWALTSQLQQLRLEHEEVATQLHLTQAALQQVLNERD     71 - 140
GLCGRLLEVERSMQVYPMPQDFVPGPEAGQYGPVAGTLNAEQSEAVATEAQGMPHSEAQVAAPTAVYYMP    141 - 210
EPQSGRVQGMQPLLLMQAPHPVPFHMPSPMGLPYSTPLPPPVVMESAAAIAPQMPPAGIYPPGLWATVGS    211 - 280
QEETAPPWDQKCHGQDGYPENFQGVYHPGDNRSCNQKEGSECPQGMTSQGDSSSHSLKKDPVMQEGTAPP    281 - 350
EFSRSHSLEKKPVMPKEMVPLGDSNSHSLKKDPVVPKEIVPIGDSNSHSLTKNPVVHKEMVSLGDSNSHS    351 - 420
MKKDPVMPQKMVPLGDSNSHSLKKDPMMCQEMVPLGDSNSHSLKKDPVVAQGTAPLMYSRRHSQKKVPMM    421 - 490
PKEMVPLGESHSHSLKKDLVVPKELVPLGDSKSHRMKKDPVMPQKMVPLGDSRSHSLKKDPVMPQNMIPL    491 - 560
EDSNSHSLKKDPVMPQNMIPLEDSNSHSLKKDPMMHQEMVPLGDSNSHSLKKDPVVPQDTAPLMFSRRHS    561 - 630
LKKVPVMPKEMVPLGDSHSLKKDPVMPQNMVPLEDSNSHSLKKDPVVPQGTAPLMFSRRHSLKKVPVMPK    631 - 700
EMVPLGDSNSHSLKKDPVVPQGTAPLMFSRRHSLKKVPVMPKEMVPLGDSHSLKKDPVMPQNMVPLEDSN    701 - 770
SHSLKKDPVVPQGTAPLTFSRRHSLKKVPVVPQGTASLGFSRIHSLKKELVMPEEMVPLGDSNSHSMKKD    771 - 840
LVMPKEMVPLGDSNSHSLKKDPVVHQEVVSLGDSNSHSLKKHPVIPQGTASLRFSKSHSQKEDQERPQVT    841 - 910
PLEDSKSHGVKNSPWKHQPQGQKVKEQKRKKASESQQQKPASCSSPVNWACPWCNAMNFPRNKVCSKCKR    911 - 980
VRMPVENGSVDPA                                                             981 - 993
//

Publication (1)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.