Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Synonym

Accession A0A0C4DH25
Symbols A11
A11a
IGKV3D20

Gene

 Compartment GO Term (0)

AA Sequence

METPAQLLFLLLLWLPDTTGEIVLTQSPATLSLSPGERATLSCGASQSVSSSYLAWYQQKPGLAPRLLIY      1 - 70
DASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP                             71 - 116
//

Text Mined References (10)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
11298326 2001 Evolutionary dynamics of the human immunoglobulin kappa locus and the germline repertoire of the Vkappa genes.
5027703 1972 [Rule of antibody structure. The primary structure of a monoclonal immunoglobulin L-chain of kappa-type, subgroup 3 (Bence-Jones protein Ti). IV. The complete amino acid sequence and its significance for the mechanism of antibody production].
3351922 1988 The human VK locus. Characterization of a duplicated region encoding 28 different immunoglobulin genes.
1249422 1976 Activation of C1r by proteolytic cleavage.