Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

AA Sequence

METPAQLLFLLLLWLPDTTGEIVLTQSPATLSLSPGERATLSCGASQSVSSSYLAWYQQKPGLAPRLLIY      1 - 70
DASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP                             71 - 116
//

Text Mined References (11)

PMID Year Title