Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A0A0B4J2F0
Symbols HP06981

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MFRRLTFAQLLFATVLGIAGGVYIFQPVFEQYAKDQKELKEKMQLVQESEEKKS                      1 - 54
//

Publication (3)

PMID Year Title
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.