Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MQYPFRKLLRPSTESCCVAQARVQWCHLGSLQPPLPGFKQFSCHSLPSSWDYRWNLTLSPRLECSGAISA      1 - 70
HCNLCLPDLSDSPASTSRVAGTTGAHHHAQEPVVIRKM                                     71 - 108
//

Text Mined References (3)

PMID Year Title