Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary


No data available

AA Sequence

HCNLCLPDLSDSPASTSRVAGTTGAHHHAQEPVVIRKM                                     71 - 108

Text Mined References (3)

PMID Year Title
16461635 2006 Decoding the fine-scale structure of a breast cancer genome and transcriptome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.