Property Summary

NCBI Gene PubMed Count 1
PubMed Score 9.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Breast cancer 3,094

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 1.400 0.000

Synonym

Accession A0A096LP55
Symbols

Gene

AA Sequence

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEE      1 - 70
LFDFLHAKDHCVAHKLFNNLK                                                      71 - 91
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
11181995 2001 The sequence of the human genome.