Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A0A096LP49 Q8N5P7
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPTLVVGTPPTCLGDTPQPCHKNSQRQGPFSHGAPGRAADWKAVAKPRLCAPAAEDDVAALRWPGPSQQP      1 - 70
DPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSCSSGGHDVCVSWKERPPQVLG     71 - 140
PQQRPRKSDARLEQLRDKIRAQAWQQGSCASLGTSAPSSASRLHKASTLMLRRKGQEAKNPPPAPECSGF    141 - 210
SILSAAERRVEAKASHGQGRELSRVSQHQVPVLREKPKRVKSSSCKREKTPKLPSPRRAAKDKHKDEDSE    211 - 280
LVGVYAWRKGQALVRSLLGPPPVLRRHHSKDPSRDPALTVDLGDSEKVIAAKCSPVCAQLPDATSAYSDQ    281 - 350
QVSGNTPSLASFDQPATIQTAMAILQDLRQQIQAGLELAQARKGGQELGPSKRRLQDVAGRGCCRDPNAQ    351 - 420
SSFSKSPWAMTERKHSSLERARSVHTWEPWSSSTARESCPQRAWGAQGQDRSFQRPESPHERLGHFSQRP    421 - 490
WSALAGQACSPQRAWGAQRQGPSSQRPGSPPEKRSPFPQQPWSAVATQPCPRRAWTACETWEDPGPRLRN    491 - 560
PLERPSPPAQRPWSSSGVQRAGPQGKGRGIGSPVSAAKHALPRPTGSFPQNPLGKEKDTLRPCPRSRGLL    561 - 630
GPSHSSESLREFMRQKAQARRRQALEEKASALRTRELRSRRLQEVYRQQREAVLGRAVPVVSRTTPGIVT    631 - 700
FVPSSAQSGGLEASGSLESPVLEWSKVTSGMVLGGQEAPGSFCLCLNRAWNHAETLDPPGMGGPQDGRDA    701 - 770
PVLLSASPSLGSLELQDLTTRYLPRGMCIYLDPKEAEHLGTSSSLHLRHKQAQLQALETTAKVLKQRVDS    771 - 840
LTAKLQGAEALDTVRDPAVGLLRSCPHSLPAAPTLATPTLATPACPGALGPNWGRGAPGEWVSMQPQPLL    841 - 910
PPTYFLDGETLSWGPSWEQQQSVSPRAHCESKPRGFPEEGHVDVKPDKRLQRGVAPFQALSPSAGSSYAG    911 - 980
PATLHPIWGSLGLEETPSVGGADSVAPCTPRSCGKGDPADRPWAGWSGGRGIHREHLPLPSTRAWPYGVE    981 - 1050
KSFSTWRASTPRY                                                            1051 - 1063
//

Text Mined References (4)

PMID Year Title
25751143 2015 Quantitative gene profiling of long noncoding RNAs with targeted RNA sequencing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.