Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.500 0.001

Gene RIF (2)

PMID Text
17494644 Observational study of genotype prevalence. (HuGE Navigator)
12171760 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLEALVPLAMIVAIFLLLVDLMHRHQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFS      1 - 70
LQLAWTPVVVLNGLAAVREAMVTRGEDTADRPPAPIYQVLGFGPRSQGVILSRYGPAWREQRRFSVSTLR     71 - 140
NLGLGKKSLEQWVTEEAACLCAAFADQAGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQ    141 - 210
EGLKEESGFLREVLNAVPVLPHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAKKE    211 - 280
KAKGSPESSFNDENLRIVVGNLFLAGMVTTSTTLAWGLLLMILHLDVQRGRRVSPGCPIVGTHVCPVRVQ    281 - 350
QEIDDVIGQVRRPEMGDQAHMPCTTAVIHEVQHFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSV    351 - 420
LKDEAVWKKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVAAGQ    421 - 490
PRPSHSRVVSFLVTPSPYELCAVPR                                                 491 - 515
//

Text Mined References (15)

PMID Year Title
26297049 2016 Coding-noncoding gene expression in intrahepatic cholangiocarcinoma.
22111604 2012 CYP2D6, SULT1A1 and UGT2B17 copy number variation: quantitative detection by multiplex PCR.
18838503 2009 Expression and functional analysis of CYP2D6.24, CYP2D6.26, CYP2D6.27, and CYP2D7 isozymes.
17494644 2007 Frequency of the frame-shifting CYP2D7 138delT polymorphism in a large, ethnically diverse sample population.
16400609 2006 Single-nucleotide polymorphisms in NAGNAG acceptors are highly predictive for variations of alternative splicing.
16169517 2005 CYP2D7 splice variants in human liver and brain: does CYP2D7 encode functional protein?
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15051713 2004 A frameshift mutation and alternate splicing in human brain generate a functional form of the pseudogene cytochrome P4502D7 that demethylates codeine to morphine.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12171760 Polymorphism of metabolic genes and susceptibility to occupational chronic manganism.
More...