Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MDVVEVAGSWWAQEREDIIMKYEKGHRAGLPEDKGPKPFRSYNNNVDHLGIVHETELPPLTAREAKQIRR      1 - 70
EISRKSKWVDMLGDWEKYKSSRKLIDQAYKGMPMNIRGPMWSVLLNTEEMKLKNPGRYQIMKEKGKKSSE     71 - 140
HIQRIDRDVSGTLRKHIFFRDRYGTKQRELLHILLAYEEYNPEVGYCRDLSHIAALFLLYLPEEDAFWAL    141 - 210
VQLLASERHSLQGFHSPNGGTVQGLQDQQEHVVATSQPKTMGHQDKKDLCGQCSPLGCLIRILIDGISLG    211 - 280
LTLRLWDVYLVEGEQALMPITRIAFKVQQKRLTKTSRCGPWARFCNRFVDTWARDEDTVLKHLRASMKKL    281 - 350
TRKKGDLPPPAKPEQGSSASRPVPASRGGKTLCKGDRQAPPGPPARFPRPIWSASPPRAPRSSTPCPGGA    351 - 420
VREDTYPVGTQGVPSPALAQGGPQGSWRFLQWNSMPRLPTDLDVEGPWFRHYDFRQSCWVRAISQEDQLA    421 - 490
PCWQAEHPAERVRSAFAAPSTDSDQGTPFRARDEQQCAPTSGPCLCGLHLESSQFPPGF               491 - 549
//

Text Mined References (3)

PMID Year Title
21030649 2010 Diversity of human copy number variation and multicopy genes.
16863688 2006 TBC1D3, a hominoid oncoprotein, is encoded by a cluster of paralogues located on chromosome 17q12.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.