Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
18718982 Single marker analysis indicated that SNP5 (rs1355095) in LOC728637 is associated with schizophrenia in Han Chinese.

AA Sequence

MWPLRVYTRKKREGQRLNLTPTPDLGSPAKAEAPPGSKRKGKVHGLSKIAEKAERSRQGGSGSGPFSPRL      1 - 70
GVTGEKSLQENRSSEDTQDEKIASLRESVTDDLQVDSSSSNSELVSGLSLHHGMASSLLSYSVTDSYAEY     71 - 140
KSFEESFPSPELFRKSDYLDWECPNLEEHMQWKNSTLLDTSKAVAIEKAPQFSNVSAIFSTSSEDYQKCH    141 - 210
RKTVMTVADQNVSPKAKCASNSESDNAACEILLAEKTCPSTPEKTKKKKTNSSTPGKKNRGLLTSTPSSE    211 - 280
TAGFVIDLSSVQKASFEELFPNVSNYVNSNEIVPVSSLQENSSNEFPANASEICCIIRTSPGTRQVKNKG    281 - 350
VIVKKKKYSLPKDTPQDIIIKMA                                                   351 - 373
//

Text Mined References (4)

PMID Year Title
25533956 2015 Meikin is a conserved regulator of meiosis-I-specific kinetochore function.
18718982 2008 Association of haplotypes spanning PDZ-GEF2, LOC728637 and ACSL6 with schizophrenia in Han Chinese.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.