Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MWPLRVYTRKKREGQRLNLTPTPDLGSPAKAEAPPGSKRKGKVHGLSKIAEKAERSRQGGSGSGPFSPRL      1 - 70
GVTGEKSLQENRSSEDTQDEKIASLRESVTDDLQVDSSSSNSELVSGLSLHHGMASSLLSYSVTDSYAEY     71 - 140
KSFEESFPSPELFRKSDYLDWECPNLEEHMQWKNSTLLDTSKAVAIEKAPQFSNVSAIFSTSSEDYQKCH    141 - 210
RKTVMTVADQNVSPKAKCASNSESDNAACEILLAEKTCPSTPEKTKKKKTNSSTPGKKNRGLLTSTPSSE    211 - 280
TAGFVIDLSSVQKASFEELFPNVSNYVNSNEIVPVSSLQENSSNEFPANASEICCIIRTSPGTRQVKNKG    281 - 350
VIVKKKKYSLPKDTPQDIIIKMA                                                   351 - 373
//

Text Mined References (4)

PMID Year Title