Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MPRMILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIR      1 - 70
SKKLEHSNDPFNVYIESNAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP             71 - 132
//

Text Mined References (1)

PMID Year Title
10830953 2000 The DNA sequence of human chromosome 21.