Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MVNSVVFFEITRDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRP      1 - 70
NGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICAAKTEWLDGKHVAFGKVKERVNIVE     71 - 140
AMEHFGYRNSKTSKKITIADCGQF                                                  141 - 164
//

Text Mined References (2)

PMID Year Title