Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Synonym

Accession A0A075B759 PPIase A-like 4E
Symbols COAS2

Gene

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
22320715 Association of increased ligand cyclophilin A and receptor CD147 with hypoxia, angiogenesis, metastasis and prognosis of tongue squamous cell carcinoma.

AA Sequence

MVNSVVFFEITRDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRP      1 - 70
NGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICAAKTEWLDGKHVAFGKVKERVNIVE     71 - 140
AMEHFGYRNSKTSKKITIADCGQF                                                  141 - 164
//

Text Mined References (2)

PMID Year Title
22320715 2012 Association of increased ligand cyclophilin A and receptor CD147 with hypoxia, angiogenesis, metastasis and prognosis of tongue squamous cell carcinoma.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.